PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10767.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 179aa    MW: 20048.5 Da    PI: 5.0806
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10767.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.43.4e-1380120445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++++ ll+++++++G g+W+ Ia+++g +++ +qc++++ 
        PK10767.3  80 WNADDEILLLEGIEMYGLGNWTEIAEHVG-TKSKEQCINHYT 120
                      *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002918.1E-81660IPR000433Zinc finger, ZZ-type
PfamPF005692.2E-82060IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.47E-142083No hitNo description
PROSITE profilePS5013510.522063IPR000433Zinc finger, ZZ-type
CDDcd023359.02E-242068No hitNo description
PROSITE patternPS0135702249IPR000433Zinc finger, ZZ-type
SuperFamilySSF466895.31E-1472126IPR009057Homeodomain-like
PROSITE profilePS5129321.97475127IPR017884SANT domain
SMARTSM007171.9E-1176125IPR001005SANT/Myb domain
PfamPF002496.9E-1379120IPR001005SANT/Myb domain
CDDcd001671.70E-1380119No hitNo description
Gene3DG3DSA:1.10.10.606.2E-980121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
GENLESTTAG QGTSEGKALY HCNYCNKDIT GKIRIKCCTC ADFDLCIECF SVGAEVQPHK  60
SNHPYRVMDN LSFPLICPDW NADDEILLLE GIEMYGLGNW TEIAEHVGTK SKEQCINHYT  120
DVYMNSPLFP LPDMSHVVGK NRKELLAMAK GHSEEKKGLP MISELDXKEE SPFSPSRIK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879306.11e-114PREDICTED: transcriptional adapter ADA2b isoform X3
SwissprotQ75LL61e-93TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLF6HCV61e-112F6HCV6_VITVI; Putative uncharacterized protein
STRINGVIT_00s0194g00130.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726